PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11573_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 266aa    MW: 30001.3 Da    PI: 9.7353
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11573_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45e-161360148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                          +g+WT +Ed++l +++k +G g W+  +++ g++R++k+c++rw++yl
  cra_locus_11573_iso_4_len_1098_ver_3 13 KGAWTSQEDKILTEYIKVHGEGKWRNLPKKAGLKRCGKSCRLRWLNYL 60
                                          79********************************************97 PP

2Myb_DNA-binding50.54.7e-1666109146
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                           rg+ T +E++l+++++k+lG++ W++Ia +++ gRt++++k++w++
  cra_locus_11573_iso_4_len_1098_ver_3  66 RGNITNDEEDLIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 109
                                           7999******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-23463IPR009057Homeodomain-like
PROSITE profilePS5129416.53860IPR017930Myb domain
SuperFamilySSF466891.54E-2811107IPR009057Homeodomain-like
SMARTSM007177.5E-131262IPR001005SANT/Myb domain
PfamPF002494.7E-141360IPR001005SANT/Myb domain
CDDcd001675.29E-91560No hitNo description
PROSITE profilePS5129423.87161115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2364115IPR009057Homeodomain-like
SMARTSM007175.5E-1565113IPR001005SANT/Myb domain
PfamPF002492.4E-1466109IPR001005SANT/Myb domain
CDDcd001672.25E-1070111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MRSPCCVKEG LNKGAWTSQE DKILTEYIKV HGEGKWRNLP KKAGLKRCGK SCRLRWLNYL  60
RPDIKRGNIT NDEEDLIIRL HKLLGNRWSL IAGRLPGRTD NEIKNYWNTN IGKRLLEGHH  120
HHPSSSTTGS KPSSSIKSSR AKKNLSKKGS SCVVRTKATR CTKVFIDAEL EQTQKPGIMA  180
TKEDGIIEKT GLETEAVAMA MAAAKVSKDN SSNFLMDIEM DDKFLYEFFR GEFITSCDLK  240
TRQDSELGSV ASLLDPSDLN WLLQDQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-261111525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275148.11e-92PREDICTED: myb-related protein Zm38
RefseqXP_007024611.11e-92Duplicated homeodomain-like superfamily protein, putative
SwissprotQ9FJA24e-65TT2_ARATH; Transcription factor TT2
TrEMBLA5AXZ46e-93A5AXZ4_VITVI; Putative uncharacterized protein
STRINGVIT_09s0002g01400.t011e-91(Vitis vinifera)